Scaffold metazooDRAFT_1404142

Overview

Basic Information

• Taxon OID: 3300003647
• Scaffold ID: metazooDRAFT_1404142
• Source Dataset Name: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 78
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Sao Paulo, Virginia Bioinformatics Institute
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 507
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location

• Location Name: Sao Paulo Zoo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020718	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
metazooDRAFT_14041421	F020718	N/A	MHESEIIPLRGEAVTLWRLARDREQLHCFLVEPPFGFWLGVERAGELVFSQTYHELDTALQQAEGLKSPLLVAGWTEVEDH*