Basic Information | |
---|---|
Taxon OID | 3300003645 Open in IMG/M |
Scaffold ID | NAP1_1016361 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 868 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Naples | |||||||
Coordinates | Lat. (o) | 40.7245 | Long. (o) | 14.3775 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003637 | Metagenome / Metatranscriptome | 476 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
NAP1_10163612 | F003637 | GAGG | MAKVIAEKVQEQVQVDSPNMVEIKHTRTMQDASGNDVEVVDYTDVKSVDEAISQCEAHKTNLEAQLTECEAELAEYIAIRDAE* |
⦗Top⦘ |