Scaffold p5metav_100333

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold p5metav_100333

Scaffold p5metav_100333

Overview

Basic Information
Taxon OID	3300003635 Open in IMG/M
Scaffold ID	p5metav_100333 Open in IMG/M
Source Dataset Name	Hypersaline viral communities from Bras del Port, Santa Pola, Spain - Lo Valdivia P5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Lifesequencing S.L.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6866
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location Name	Bras del Port, Santa Pola, Spain
Coordinates	Lat. (^o)	38.192206	Long. (^o)	-0.591865	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074590	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
p5metav_10033311	F074590	AGGAG	MVVSIRLWHVFGLSVESVEAQPIYGHMPHESEEDAQVFFFDGYIINIPFVKIMIGDVWGIADN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.