NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26382J51730_1005193

Scaffold JGI26382J51730_1005193


Overview

Basic Information
Taxon OID3300003601 Open in IMG/M
Scaffold IDJGI26382J51730_1005193 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4404
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
unclassified Hyphomonas → Hyphomonas sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)125
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078736Metagenome / Metatranscriptome116Y
F099999Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
JGI26382J51730_10051931F078736GGAGGMTDELKEWYLMPSITECLVEYEKQDIGLIADIAKHGCSGGVAGIVYYDETTSFH
JGI26382J51730_10051937F099999N/AMPKRLKLSPKTLQQLKKASWTEWLDAFNQVHNSTITTSIGKIKVEIDD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.