Scaffold Ga0008455J51687_1017292

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0008455J51687_1017292

Scaffold Ga0008455J51687_1017292

Overview

Basic Information
Taxon OID	3300003566 Open in IMG/M
Scaffold ID	Ga0008455J51687_1017292 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_07_M0_10 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	504
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	Monterey Bay, California, USA
Coordinates	Lat. (^o)	36.25	Long. (^o)	-122.2099	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052640	Metagenome / Metatranscriptome	142	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0008455J51687_10172922	F052640	AGGAGG	MSNPSIKTIDELEAQYYGYNRNFLRKADSPVTTSTAGVFNAIFGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.