Basic Information | |
---|---|
Taxon OID | 3300003552 Open in IMG/M |
Scaffold ID | Ga0006715J51105_132887 Open in IMG/M |
Source Dataset Name | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - QV1.2_AUG13 (Metagenome Metatranscriptome, Counting Only) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 554 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California, McLaughlin Reserve | |||||||
Coordinates | Lat. (o) | 38.8739528 | Long. (o) | -122.4391613 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090615 | Metagenome / Metatranscriptome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0006715J51105_1328871 | F090615 | N/A | VVRAAPVPAPAQKPTPAASGTLTRSEKLAQMRALQLAAPEPTDPSLIAALRVRKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDPEGKSIPAKLFNEIAAEYLKTVPQTRLLIEESAVEHQAFWDADQPYIDQSDEDIHEEMVTAIKMANADRLRAARAKASAGS* |
⦗Top⦘ |