3300003552: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - QV1.2_AUG13 (Metagenome Metatranscriptome, Counting Only)

Overview

Basic Information

• IMG/M Taxon OID: 3300003552
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053062 | Gp0061241 | Ga0006715
• Sample Name: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - QV1.2_AUG13 (Metagenome Metatranscriptome, Counting Only)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 23717608
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → planetary subsurface zone → rock
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: California, McLaughlin Reserve
• Coordinates
  • Lat. (^o): 38.8739528
  • Long. (^o): -122.4391613
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090615	Metagenome / Metatranscriptome	108	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0006715J51105_132887	Not Available	554

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0006715J51105_132887	Ga0006715J51105_1328871	F090615	VVRAAPVPAPAQKPTPAASGTLTRSEKLAQMRALQLAAPEPTDPSLIAALRVRKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDPEGKSIPAKLFNEIAAEYLKTVPQTRLLIEESAVEHQAFWDADQPYIDQSDEDIHEEMVTAIKMANADRLRAARAKASAGS*