| Basic Information | |
|---|---|
| Taxon OID | 3300003517 Open in IMG/M |
| Scaffold ID | Antarctic1_1272086 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Antarctic Ocean - Station_363 -- 3.0 um |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 562 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -60.00007 | Long. (o) | 141.23353 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067116 | Metagenome / Metatranscriptome | 126 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Antarctic1_12720861 | F067116 | GGAG | MKSLKSIILETTDGDYQIDTHLVKMKTLTSIERKFKDQNIVAIIRIDEDQFMVFVEIE* |
| ⦗Top⦘ |