NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Antarctic1_1270622

Scaffold Antarctic1_1270622


Overview

Basic Information
Taxon OID3300003517 Open in IMG/M
Scaffold IDAntarctic1_1270622 Open in IMG/M
Source Dataset NameMarine microbial communities from Antarctic Ocean - Station_363 -- 3.0 um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)535
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-60.00007Long. (o)141.23353Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000057Metagenome / Metatranscriptome3033Y

Sequences

Protein IDFamilyRBSSequence
Antarctic1_12706222F000057AGGAGMASKFNSEFNYRYQVIGDTPWEKIKTLQGFLEGRIRAAALEEVSVLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.