Basic Information | |
---|---|
Taxon OID | 3300003517 Open in IMG/M |
Scaffold ID | Antarctic1_1267962 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Antarctic Ocean - Station_363 -- 3.0 um |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 518 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | -60.00007 | Long. (o) | 141.23353 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056914 | Metagenome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Antarctic1_12679621 | F056914 | AGGAG | MNLFTQTIANQIPTGLDRYDQIFAAKRLILASDSPILATCRETLEEIEEIIFQRDKKELTNA* |
⦗Top⦘ |