Scaffold Antarctic1_1266531

Overview

Basic Information

• Taxon OID: 3300003517
• Scaffold ID: Antarctic1_1266531
• Source Dataset Name: Marine microbial communities from Antarctic Ocean - Station_363 -- 3.0 um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 513
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -60.00007
  • Long. (^o): 141.23353
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083254	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Antarctic1_12665312	F083254	N/A	IQTLGPGSKKHFHLVPGSLIEKLAASSLKLEAWRLDLESIAQKFDDVGLTLENLGA*