Basic Information | |
---|---|
Taxon OID | 3300003517 Open in IMG/M |
Scaffold ID | Antarctic1_1266531 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Antarctic Ocean - Station_363 -- 3.0 um |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | -60.00007 | Long. (o) | 141.23353 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F083254 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Antarctic1_12665312 | F083254 | N/A | IQTLGPGSKKHFHLVPGSLIEKLAASSLKLEAWRLDLESIAQKFDDVGLTLENLGA* |
⦗Top⦘ |