Scaffold Antartic2_1256727

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Antartic2_1256727

Scaffold Antartic2_1256727

Overview

Basic Information
Taxon OID	3300003516 Open in IMG/M
Scaffold ID	Antartic2_1256727 Open in IMG/M
Source Dataset Name	Marine microbial communities from Antarctic ocean - Station_363 -- 0.8 um
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1026
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-60.00007	Long. (^o)	141.23353	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022528	Metagenome	214	N

Sequences

Protein ID	Family	RBS	Sequence
Antartic2_12567272	F022528	N/A	MWVLVWMQLISGQPVDYFQLAVYESNVECEKNRKHAEIMVTHNGIAVACLEVKI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.