Scaffold Antartic2_1244149

Overview

Basic Information

• Taxon OID: 3300003516
• Scaffold ID: Antartic2_1244149
• Source Dataset Name: Marine microbial communities from Antarctic ocean - Station_363 -- 0.8 um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 507
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater → Marine Microbial Communities From Antarctic Lakes And Southern Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -60.00007
  • Long. (^o): 141.23353
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008886	Metagenome / Metatranscriptome	326	Y

Sequences

Protein ID	Family	RBS	Sequence
Antartic2_12441492	F008886	N/A	AGEPFGWNGNYIMNDMVTQGAVRNRPVVTFTNGTSGTRVVDVAIFIGG*