Scaffold FS848_1004106

Overview

Basic Information

• Taxon OID: 3300003509
• Scaffold ID: FS848_1004106
• Source Dataset Name: Marine hydrothermal diffuse flow vent microbial communities from the Mid-Cayman Rise, Caribbean Sea - Sample FS848
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3196
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Diffuse Flow Vent → Marine Hydrothermal Diffuse Flow Vent Microbial Communities From The Mid-Cayman Rise, Caribbean Sea

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise
• Coordinates
  • Lat. (^o): 18.376929
  • Long. (^o): -81.797906
  • Depth (m): 2308

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052659	Metagenome / Metatranscriptome	142	N

Sequences

Protein ID	Family	RBS	Sequence
FS848_10041062	F052659	N/A	MLLSGNPGTETRSAVFIDGRLISSIPELNYQTIDKLQQGGVPDKVSWMKPSLRGRLRLVKLQAQERNLTIEDLNQSIRSKWVILWAEV*