3300003509: Marine hydrothermal diffuse flow vent microbial communities from the Mid-Cayman Rise, Caribbean Sea - Sample FS848

Overview

Basic Information

• IMG/M Taxon OID: 3300003509
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111537 | Gp0106822 | Ga0060303
• Sample Name: Marine hydrothermal diffuse flow vent microbial communities from the Mid-Cayman Rise, Caribbean Sea - Sample FS848
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 57973490
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Hydrothermal Diffuse Flow Vent Microbial Communities From The Mid-Cayman Rise, Caribbean Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Diffuse Flow Vent → Marine Hydrothermal Diffuse Flow Vent Microbial Communities From The Mid-Cayman Rise, Caribbean Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Mid-Cayman Rise
• Coordinates
  • Lat. (^o): 18.376929
  • Long. (^o): -81.797906
  • Alt. (m): N/A
  • Depth (m): 2308

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052659	Metagenome / Metatranscriptome	142	N

Associated Scaffolds

Scaffold	Taxonomy	Length
FS848_1004106	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005	3196

Sequences

Scaffold ID	Protein ID	Family	Sequence
FS848_1004106	FS848_10041062	F052659	MLLSGNPGTETRSAVFIDGRLISSIPELNYQTIDKLQQGGVPDKVSWMKPSLRGRLRLVKLQAQERNLTIEDLNQSIRSKWVILWAEV*