| Basic Information | |
|---|---|
| Taxon OID | 3300003473 Open in IMG/M |
| Scaffold ID | FeGluAir_10039860 Open in IMG/M |
| Source Dataset Name | Fe-reducing enrichment culture from wetland. Sample 3 with anaerobic and aerobic cycling. |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1189 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Dorn Creek (Dane County, WI) | |||||||
| Coordinates | Lat. (o) | 43.135131 | Long. (o) | -89.441777 | Alt. (m) | Depth (m) | 0 to .3048 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063150 | Metagenome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FeGluAir_100398603 | F063150 | AGGAGG | MRLSIVLAALLIAGTAQATSYVPQFPQGLEQFTTIEGIKFNDASGKHNPPSIPKSWKLISVSNGEKANANNLWFQDSDGSVYLLQGFTSRNKFIIHEHVYKIPAK* |
| ⦗Top⦘ |