| Basic Information | |
|---|---|
| Taxon OID | 3300003472 Open in IMG/M |
| Scaffold ID | BeaverFeces_1056389 Open in IMG/M |
| Source Dataset Name | Beaver gut microbial communities from British Columbia, Canada - Beaver Fecal Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Genome Quebec |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 986 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Beaver Gut → Beaver Gut Microbial Communities From British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Langley Township, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.01063 | Long. (o) | -122.625468 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059106 | Metagenome | 134 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BeaverFeces_10563893 | F059106 | N/A | FGKIRVILLQTFVWIVDLKVRETFNRVFKERYKISRVIIGVFV* |
| ⦗Top⦘ |