NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BeaverFeces_1029222

Scaffold BeaverFeces_1029222


Overview

Basic Information
Taxon OID3300003472 Open in IMG/M
Scaffold IDBeaverFeces_1029222 Open in IMG/M
Source Dataset NameBeaver gut microbial communities from British Columbia, Canada - Beaver Fecal Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGenome Quebec
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1484
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Beaver Gut → Beaver Gut Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location NameCanada: Langley Township, British Columbia
CoordinatesLat. (o)49.01063Long. (o)-122.625468Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019676Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
BeaverFeces_10292223F019676N/AMAICSLALASLLVGCDRQVSSEKSSTVGSDGTVKSKEKTVTTSPDGTVTKTEESKKTTPPEKP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.