Scaffold FeGluNO3_10467378

Overview

Basic Information

• Taxon OID: 3300003471
• Scaffold ID: FeGluNO3_10467378
• Source Dataset Name: Fe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions.
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 886
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures

Source Dataset Sampling Location

• Location Name: Dorn Creek (Dane County, WI)
• Coordinates
  • Lat. (^o): 43.135131
  • Long. (^o): -89.441777
  • Depth (m): 0 to .3048

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063150	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
FeGluNO3_104673781	F063150	AGGAGG	MRLTIFLAALLITGAAQATSYVPQFPKGLEQFTTIEGIKFKDASGGASNPPSIPKSWKLISVSSGEKSNSNNLWFQDADGSVYLLQGFTSQNKFIIHEHVYKIPAK*