| Basic Information | |
|---|---|
| Taxon OID | 3300003460 Open in IMG/M |
| Scaffold ID | DC01B_1416153 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S2-DC01B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 551 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Douglas Channel, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 53.6667 | Long. (o) | -129.1333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065794 | Metagenome / Metatranscriptome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DC01B_14161531 | F065794 | GAG | MQDIKIYALNLLSLAVSFTHVEMVLKLILLAASIVYTAQRIWINYNEKKNK* |
| ⦗Top⦘ |