Scaffold DC05C_1077707

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DC05C_1077707

Scaffold DC05C_1077707

Overview

Basic Information
Taxon OID	3300003451 Open in IMG/M
Scaffold ID	DC05C_1077707 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S6-DC05C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	541
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Source Dataset Sampling Location
Location Name	Douglas Channel, British Columbia, Canada
Coordinates	Lat. (^o)	53.6667	Long. (^o)	-129.1333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102144	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
DC05C_10777071	F102144	AGG	MVSLKEMWSPSRIRTEANNIEDYLFKTTKRLMRLERQYRLKKMEYLAGIEAYEERLKWLTAEME*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.