NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003451

3300003451: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S6-DC05C



Overview

Basic Information
IMG/M Taxon OID3300003451 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111425 | Gp0104219 | Ga0059321
Sample NameMarine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S6-DC05C
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size39393659
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine neritic zonemarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationDouglas Channel, British Columbia, Canada
CoordinatesLat. (o)53.6667Long. (o)-129.1333Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095491Metagenome105Y
F099879Metagenome / Metatranscriptome103N
F102144Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
DC05C_1077707Not Available541Open in IMG/M
DC05C_1142940Not Available518Open in IMG/M
DC05C_1291265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria521Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
DC05C_1077707DC05C_10777071F102144MVSLKEMWSPSRIRTEANNIEDYLFKTTKRLMRLERQYRLKKMEYLAGIEAYEERLKWLTAEME*
DC05C_1142940DC05C_11429402F099879MANKEKKVEVPETIMVHCTDNGQDVEVNYISQHNGIIRTDLQGMPLYFKHHRSNIYVGNMLGREFVMKL*
DC05C_1291265DC05C_12912651F095491AGALVEKLIEELEKLIEPEIKSFLADSTERVLERAAEFTIAKIDDPASIEFRATFVRFMLSQSPAFFLEAADDELIDDMGAVVEMTARHLAETPETREGNGEWIDRAMDYVAGKTLGEALEMDGSRARPPIDALADATWPAFTTVLASPQAQAWMDTLLEELIDEYERIGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.