Scaffold ERB454_1012319

Overview

Basic Information

• Taxon OID: 3300003442
• Scaffold ID: ERB454_1012319
• Source Dataset Name: Combined Assembly of Gp0111447, Gp0111475, Gp0111489
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Los Angeles, University of Waikato
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 854
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole Sediment → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic

Source Dataset Sampling Location

• Location Name: Mt. Erebus, Antarctica
• Coordinates
  • Lat. (^o): -77.533333
  • Long. (^o): 167.116667
  • Depth (m): 0 to .04

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038873	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
ERB454_10123192	F038873	N/A	FVGAPNESRLREIFGGSLLSRMVRKLPGIDIRVVASRADRPKRPGQ*