3300003442: Combined Assembly of Gp0111447, Gp0111475, Gp0111489

Overview

Basic Information

• IMG/M Taxon OID: 3300003442
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0075598 | Gp0111447 | Ga0059330
• Sample Name: Combined Assembly of Gp0111447, Gp0111475, Gp0111489
• Sequencing Status: Permanent Draft
• Sequencing Center: University of California, Los Angeles, University of Waikato
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 39702683
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole Sediment → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: Mt. Erebus, Antarctica
• Coordinates
  • Lat. (^o): -77.533333
  • Long. (^o): 167.116667
  • Alt. (m): N/A
  • Depth (m): 0 to .04

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038873	Metagenome / Metatranscriptome	165	Y
F042051	Metagenome / Metatranscriptome	159	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
ERB454_1012319	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	854
ERB454_1024611	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	755

Sequences

Scaffold ID	Protein ID	Family	Sequence
ERB454_1012319	ERB454_10123192	F038873	FVGAPNESRLREIFGGSLLSRMVRKLPGIDIRVVASRADRPKRPGQ*
ERB454_1024611	ERB454_10246111	F042051	MTTFGEISWNDDVFVGSDNGKKNNNKDLFLRLEEGSNEMRLVTQPYQYLVHKFKKDPNNPRDFGQKVGCSSIHGSCPLCADGEKAKPRWLIGVISRKSGTYKILDISFAVFSQIRKLARNTQRWGDPTKYDIDIVVDKNGGATGYYSVQPISKEPLSAADQKIKDDADLEDLKRRVTPLTPDQVQKRIDRIMSLGDAASAATAPAT