| Basic Information | |
|---|---|
| Taxon OID | 3300003440 Open in IMG/M |
| Scaffold ID | PWMHGC_102060 Open in IMG/M |
| Source Dataset Name | Hydrocarbon microbial community from Medicine Hat (2PWMHGC) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1802 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Subsurface Hydrocarbon → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Medicine Hat, Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 56.22 | Long. (o) | -117.33 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055749 | Metagenome / Metatranscriptome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PWMHGC_1020605 | F055749 | AGAAG | MNLIIAIAIGILTLIAVFSVIPVVGGSIDNAMPTLGADSEWNTTVNSDLPSGASMWSQLGPLLVLAVLAMVIGLVIMYFRNAAG* |
| ⦗Top⦘ |