| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003440 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111382 | Gp0104305 | Ga0059305 |
| Sample Name | Hydrocarbon microbial community from Medicine Hat (2PWMHGC) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 18425208 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Subsurface Hydrocarbon → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → hydrocarbon-based environmental material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Medicine Hat, Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 56.22 | Long. (o) | -117.33 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055749 | Metagenome / Metatranscriptome | 138 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| PWMHGC_102060 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | 1802 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| PWMHGC_102060 | PWMHGC_1020605 | F055749 | MNLIIAIAIGILTLIAVFSVIPVVGGSIDNAMPTLGADSEWNTTVNSDLPSGASMWSQLGPLLVLAVLAMVIGLVIMYFRNAAG* |
| ⦗Top⦘ |