Basic Information | |
---|---|
Taxon OID | 3300003437 Open in IMG/M |
Scaffold ID | draft_100611 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the San Pedro channel, Pacific Ocean in the San Pedro Ocean Time-series (SPOT) study- Sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 11684 |
Total Scaffold Genes | 14 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The San Pedro Channel, Pacific Ocean In The San Pedro Ocean Time-Series (Spot) Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | San Pedro Channel, Pacific | |||||||
Coordinates | Lat. (o) | 33.55 | Long. (o) | -118.42 | Alt. (m) | Depth (m) | 890 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063768 | Metagenome / Metatranscriptome | 129 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_1006117 | F063768 | GAGG | MDMEAVQDPLTTAEGVAEFVVLAELSRALSERLAGWSVDGAGPGSSATMASLASRLDEHSTWWTERIPESVLLEGERTAASGSGRLVEVLDLLDVPASDRNAAVVPVLDRLVAYLGALAERLSPLGDAPALRTIRLVLADLVDRPR* |
⦗Top⦘ |