| Basic Information | |
|---|---|
| Taxon OID | 3300003432 Open in IMG/M |
| Scaffold ID | JGI20214J51088_10068996 Open in IMG/M |
| Source Dataset Name | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2474 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sacramento, California, United States | |||||||
| Coordinates | Lat. (o) | 38.1072 | Long. (o) | -121.6485 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085855 | Metagenome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20214J51088_100689962 | F085855 | GAGG | MQNKDNQNTINIEPFINRINAYVFKFMEKSITGKLIEKNGDYLTIELKSGSVIVAHIDSLVSIWNIRQKQEMV* |
| ⦗Top⦘ |