Scaffold JGI25856J50185_10184

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25856J50185_10184

Scaffold JGI25856J50185_10184

Overview

Basic Information
Taxon OID	3300003424 Open in IMG/M
Scaffold ID	JGI25856J50185_10184 Open in IMG/M
Source Dataset Name	Upper troposphere microbial communities - SEAC4RS-RF10-012
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	765
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location
Location Name	USA and various oceans
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032274	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25856J50185_101841	F032274	AGG	MQGFFDFTEQIEIXKXKRHKTLWTPKHDWRVAPKIIVTDEYIALDKKLEPIENELFDLIKQMPLAVEEKIKGKICVVNSGHTVDAELINRVRVLRKEASAIGKQLDELFFRTNKKWALFYDYTDKT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.