Scaffold JGI25856J50185_10056

Overview

Basic Information

• Taxon OID: 3300003424
• Scaffold ID: JGI25856J50185_10056
• Source Dataset Name: Upper troposphere microbial communities - SEAC4RS-RF10-012
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1388
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin331 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location

• Location Name: USA and various oceans
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058997	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25856J50185_100562	F058997	GGA	MIIYKXQQMTVREAXXLMXIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG*