NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25858J50188_10065

Scaffold JGI25858J50188_10065


Overview

Basic Information
Taxon OID3300003423 Open in IMG/M
Scaffold IDJGI25858J50188_10065 Open in IMG/M
Source Dataset NameUpper troposphere microbial communities - SEAC4RS-RF6-003
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1034
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Source Dataset Sampling Location
Location NameUSA and various oceans
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055725Metagenome / Metatranscriptome138Y
F058997Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
JGI25858J50188_100651F055725N/AFFNGCGINLKTITELAAQGLSLNSMSKMTGHSKNGIKAALERNNIPYTMGIRECFITVDGVLTSLGDACNAQGFSRESMYAWRVKRGLNEQDGFDAYIIYQQSKRTIDKPILTFKNTTVIYKKERYTLDAISDKLKLNKQRFEVFMRHNRYGQNAFERYCWTRGL*
JGI25858J50188_100652F058997GGAMIIYKDQQMTVREAXKLMGIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.