Basic Information | |
---|---|
IMG/M Taxon OID | 3300003423 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085223 | Ga0007669 |
Sample Name | Upper troposphere microbial communities - SEAC4RS-RF6-003 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 1795335 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Predicted Viral | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Type | Environmental |
Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA and various oceans | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055725 | Metagenome / Metatranscriptome | 138 | Y |
F058997 | Metagenome / Metatranscriptome | 134 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI25858J50188_10065 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI25858J50188_10065 | JGI25858J50188_100651 | F055725 | FFNGCGINLKTITELAAQGLSLNSMSKMTGHSKNGIKAALERNNIPYTMGIRECFITVDGVLTSLGDACNAQGFSRESMYAWRVKRGLNEQDGFDAYIIYQQSKRTIDKPILTFKNTTVIYKKERYTLDAISDKLKLNKQRFEVFMRHNRYGQNAFERYCWTRGL* |
JGI25858J50188_10065 | JGI25858J50188_100652 | F058997 | MIIYKDQQMTVREAXKLMGIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG* |
⦗Top⦘ |