| Basic Information | |
|---|---|
| Taxon OID | 3300003421 Open in IMG/M |
| Scaffold ID | JGI25855J50184_10037 Open in IMG/M |
| Source Dataset Name | Upper troposphere microbial communities - SEAC4RS-RF10-011 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1519 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA and various oceans | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043390 | Metagenome / Metatranscriptome | 156 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI25855J50184_100372 | F043390 | GGAG | MSYQVKTEDLQKVISLTLTAEQLETIAGALELYCIGLAEHNDPHLKYAADAQDAIIDVLESIFSVEE* |
| ⦗Top⦘ |