Scaffold JGI26528J50254_1009045

Overview

Basic Information

• Taxon OID: 3300003402
• Scaffold ID: JGI26528J50254_1009045
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3108
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.936637
  • Long. (^o): 18.478905

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069970	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26528J50254_10090453	F069970	N/A	MNTLHPKQAIKTGDKVIFDTDKIEVFKAETGGPDEAIRQYRQLVLGGVDQIGIVKEFGNNLTTVSYPDGWDLPVPTKYLIVLPEES*