| Basic Information | |
|---|---|
| Taxon OID | 3300003314 Open in IMG/M |
| Scaffold ID | ProkHueca_1080668 Open in IMG/M |
| Source Dataset Name | Hypersaline bacterial communities from Bras del Port, Santa Pola, Spain - Pena Hueca_Prokaryotes |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Lifesequencing S.L. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 765 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → unclassified Halorubrum → Halorubrum sp. 48-1-W | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pena Hueca, Alava, Spain | |||||||
| Coordinates | Lat. (o) | 42.65689 | Long. (o) | -2.670449 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098766 | Metagenome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ProkHueca_10806683 | F098766 | AGGAGG | MSHPSCAICGREADGADHVKIDVERVPPEEPPETYYFHKRCFDRSQSWERGL* |
| ⦗Top⦘ |