Scaffold ProkHueca_1028005

Overview

Basic Information

• Taxon OID: 3300003314
• Scaffold ID: ProkHueca_1028005
• Source Dataset Name: Hypersaline bacterial communities from Bras del Port, Santa Pola, Spain - Pena Hueca_Prokaryotes
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Lifesequencing S.L.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2238
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kirjokansivirales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location

• Location Name: Pena Hueca, Alava, Spain
• Coordinates
  • Lat. (^o): 42.65689
  • Long. (^o): -2.670449
  • Depth (m): .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
ProkHueca_10280054	F066493	AGGTGG	MSEREWKDGVVDVADELVQQNSAEGAIERLQTRRKTSSDELQARCNEAIAYIRREVQTDE