Scaffold P32013IDBA_1028404

Overview

Basic Information

• Taxon OID: 3300003313
• Scaffold ID: P32013IDBA_1028404
• Source Dataset Name: Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sample
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Campinas
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1864
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine

Source Dataset Sampling Location

• Location Name: Mina do Sossego, Brazil
• Coordinates
  • Lat. (^o): -6.426389
  • Long. (^o): -50.051389

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087721	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
P32013IDBA_10284042	F087721	AGG	VRRPYARVVLPALRDSRGKPAAPLRLLALLVALGMLALAAPAVVPVLRWLVGAVL*