Scaffold LKpool_1043276

Overview

Basic Information

• Taxon OID: 3300003311
• Scaffold ID: LKpool_1043276
• Source Dataset Name: Looe Key pool
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease

Source Dataset Sampling Location

• Location Name: Looe Key National Marine Sanctuary, Florida, USA
• Coordinates
  • Lat. (^o): 24.5484806
  • Long. (^o): -81.4059137

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048764	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
LKpool_10432761	F048764	N/A	LKAVCRHSNVFESFYFQIRKLFAGVLYEMSVPGNLLPTFSEMTFRAMKAERKVNRVTFKKTEAEPGDTLYVDVPKLNKNEVIVPGSLGLLFNIDLSGGHANNFLVQNVTRALVERMIVKFGGTILEDTHGYNVYKTFEDLFLSQEKREGMILEGIQSEDLCKIRSGAGDKKT