Basic Information | |
---|---|
Taxon OID | 3300003309 Open in IMG/M |
Scaffold ID | Guam_1001440 Open in IMG/M |
Source Dataset Name | Guam |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4009 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Acroporidae → Acropora | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Luminao reef flat, Guam | |||||||
Coordinates | Lat. (o) | 13.4644 | Long. (o) | 144.6439 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014703 | Metagenome / Metatranscriptome | 260 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Guam_10014404 | F014703 | N/A | MGNVAEKQGLPLQQHFPYKFSYSFKTSDCHKISCFNDGGLKFGHFDILDMLFPFLAFVKL |
⦗Top⦘ |