| Basic Information | |
|---|---|
| Taxon OID | 3300003307 Open in IMG/M |
| Scaffold ID | Ga0006883J46559_1017906 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 15903 |
| Total Scaffold Genes | 29 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (31.03%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Elkhorn Slough, Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.7999 | Long. (o) | -121.7999 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001506 | Metagenome / Metatranscriptome | 681 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0006883J46559_10179066 | F001506 | N/A | MNRILYEIRCKCKENISITKKRKSTSRTEGKRLVYPKSNELTSKSFQIEYEKKLSSVAKCLLNSFQHKYFYYAVDDILYLCKSNAKERENLLAILYSPVILLQNNLFINFFDIWIQEIYITEVLKSNKFLKTTDSNVESFHSITIKLLYRTKTPVKQQESLW* |
| ⦗Top⦘ |