| Basic Information | |
|---|---|
| Taxon OID | 3300003277 Open in IMG/M |
| Scaffold ID | JGI25908J49247_10116406 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 635 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Michigan, USA | |||||||
| Coordinates | Lat. (o) | 43.1998 | Long. (o) | -86.5698 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020168 | Metagenome / Metatranscriptome | 225 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI25908J49247_101164062 | F020168 | GAG | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWENK* |
| ⦗Top⦘ |