| Basic Information | |
|---|---|
| Family ID | F020168 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTDMIGSVIAIILIAFLCSPIVLAVYMWRGAKVDNDHDGKDDVPYRWEKQ |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 84.89 % |
| % of genes near scaffold ends (potentially truncated) | 18.67 % |
| % of genes from short scaffolds (< 2000 bps) | 73.78 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (64.889 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (26.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (49.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.18% β-sheet: 0.00% Coil/Unstructured: 62.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 5.33 |
| PF13830 | DUF4192 | 0.89 |
| PF02467 | Whib | 0.89 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.89 |
| PF13828 | DUF4190 | 0.44 |
| PF02867 | Ribonuc_red_lgC | 0.44 |
| PF00685 | Sulfotransfer_1 | 0.44 |
| PF04820 | Trp_halogenase | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.00 % |
| Unclassified | root | N/A | 24.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559019|stn_contig15239 | Not Available | 507 | Open in IMG/M |
| 2199352004|2199790765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 522 | Open in IMG/M |
| 2199352004|2199816734 | Not Available | 6242 | Open in IMG/M |
| 3300000736|JGI12547J11936_1013350 | All Organisms → Viruses → Predicted Viral | 2072 | Open in IMG/M |
| 3300000756|JGI12421J11937_10014287 | Not Available | 3005 | Open in IMG/M |
| 3300000756|JGI12421J11937_10140189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 608 | Open in IMG/M |
| 3300001282|B570J14230_10072556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1084 | Open in IMG/M |
| 3300001838|RCM33_1000223 | Not Available | 1840 | Open in IMG/M |
| 3300001843|RCM34_1075918 | Not Available | 1444 | Open in IMG/M |
| 3300002272|B570J29579_102804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 880 | Open in IMG/M |
| 3300002835|B570J40625_100000179 | Not Available | 98877 | Open in IMG/M |
| 3300002835|B570J40625_100015630 | Not Available | 13272 | Open in IMG/M |
| 3300003277|JGI25908J49247_10116406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 635 | Open in IMG/M |
| 3300003388|JGI25910J50241_10009885 | All Organisms → Viruses → Predicted Viral | 3428 | Open in IMG/M |
| 3300003413|JGI25922J50271_10025736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1439 | Open in IMG/M |
| 3300003413|JGI25922J50271_10035332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1175 | Open in IMG/M |
| 3300003413|JGI25922J50271_10037892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1124 | Open in IMG/M |
| 3300003413|JGI25922J50271_10067958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 777 | Open in IMG/M |
| 3300003413|JGI25922J50271_10088241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 663 | Open in IMG/M |
| 3300003413|JGI25922J50271_10139338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 507 | Open in IMG/M |
| 3300003429|JGI25914J50564_10013379 | All Organisms → Viruses → Predicted Viral | 2564 | Open in IMG/M |
| 3300003491|JGI25924J51412_1027708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 954 | Open in IMG/M |
| 3300003493|JGI25923J51411_1013606 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300003493|JGI25923J51411_1023519 | Not Available | 1230 | Open in IMG/M |
| 3300003493|JGI25923J51411_1047088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 785 | Open in IMG/M |
| 3300003499|JGI25930J51415_1079391 | Not Available | 546 | Open in IMG/M |
| 3300004054|Ga0063232_10050442 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300004054|Ga0063232_10144643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 691 | Open in IMG/M |
| 3300004112|Ga0065166_10504833 | Not Available | 513 | Open in IMG/M |
| 3300005517|Ga0070374_10501700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 605 | Open in IMG/M |
| 3300005580|Ga0049083_10227520 | Not Available | 631 | Open in IMG/M |
| 3300005581|Ga0049081_10252510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 618 | Open in IMG/M |
| 3300005662|Ga0078894_10187089 | Not Available | 1872 | Open in IMG/M |
| 3300005662|Ga0078894_10822456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 811 | Open in IMG/M |
| 3300005662|Ga0078894_11132876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 666 | Open in IMG/M |
| 3300005662|Ga0078894_11756927 | Not Available | 507 | Open in IMG/M |
| 3300005941|Ga0070743_10226136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 611 | Open in IMG/M |
| 3300005941|Ga0070743_10241876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 587 | Open in IMG/M |
| 3300006484|Ga0070744_10008059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3142 | Open in IMG/M |
| 3300006484|Ga0070744_10009437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2896 | Open in IMG/M |
| 3300006484|Ga0070744_10066482 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300006484|Ga0070744_10071497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1007 | Open in IMG/M |
| 3300006484|Ga0070744_10238061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 515 | Open in IMG/M |
| 3300006641|Ga0075471_10616228 | Not Available | 532 | Open in IMG/M |
| 3300007544|Ga0102861_1011849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2094 | Open in IMG/M |
| 3300007545|Ga0102873_1079351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 996 | Open in IMG/M |
| 3300007547|Ga0102875_1117558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 844 | Open in IMG/M |
| 3300007547|Ga0102875_1139189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 765 | Open in IMG/M |
| 3300007548|Ga0102877_1095003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 851 | Open in IMG/M |
| 3300007549|Ga0102879_1047813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1376 | Open in IMG/M |
| 3300007549|Ga0102879_1069018 | Not Available | 1117 | Open in IMG/M |
| 3300007550|Ga0102880_1178146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 555 | Open in IMG/M |
| 3300007551|Ga0102881_1063406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1031 | Open in IMG/M |
| 3300007553|Ga0102819_1014635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1344 | Open in IMG/M |
| 3300007555|Ga0102817_1133441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 552 | Open in IMG/M |
| 3300007560|Ga0102913_1255496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 560 | Open in IMG/M |
| 3300007562|Ga0102915_1052173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1347 | Open in IMG/M |
| 3300007590|Ga0102917_1056320 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
| 3300007597|Ga0102919_1205559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 616 | Open in IMG/M |
| 3300007600|Ga0102920_1174096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 690 | Open in IMG/M |
| 3300007617|Ga0102897_1108822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 855 | Open in IMG/M |
| 3300007618|Ga0102896_1252417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 546 | Open in IMG/M |
| 3300007618|Ga0102896_1266852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 527 | Open in IMG/M |
| 3300007620|Ga0102871_1045885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1293 | Open in IMG/M |
| 3300007620|Ga0102871_1046655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1280 | Open in IMG/M |
| 3300007620|Ga0102871_1053248 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300007624|Ga0102878_1074100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1022 | Open in IMG/M |
| 3300007629|Ga0102895_1206218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 509 | Open in IMG/M |
| 3300007630|Ga0102903_1183500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 570 | Open in IMG/M |
| 3300007634|Ga0102901_1104632 | Not Available | 808 | Open in IMG/M |
| 3300007634|Ga0102901_1160147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 638 | Open in IMG/M |
| 3300007636|Ga0102856_1082105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 534 | Open in IMG/M |
| 3300007642|Ga0102876_1134718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 663 | Open in IMG/M |
| 3300007647|Ga0102855_1123976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 691 | Open in IMG/M |
| 3300007649|Ga0102912_1062809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1076 | Open in IMG/M |
| 3300007661|Ga0102866_1163940 | Not Available | 566 | Open in IMG/M |
| 3300007692|Ga0102823_1194415 | Not Available | 542 | Open in IMG/M |
| 3300007708|Ga0102859_1062467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1044 | Open in IMG/M |
| 3300007708|Ga0102859_1280183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 503 | Open in IMG/M |
| 3300007954|Ga0105739_1010094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1852 | Open in IMG/M |
| 3300007992|Ga0105748_10223268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 787 | Open in IMG/M |
| 3300007992|Ga0105748_10254425 | Not Available | 738 | Open in IMG/M |
| 3300007992|Ga0105748_10502365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 530 | Open in IMG/M |
| 3300008052|Ga0102893_1142684 | Not Available | 702 | Open in IMG/M |
| 3300008107|Ga0114340_1026419 | Not Available | 2689 | Open in IMG/M |
| 3300008108|Ga0114341_10021283 | Not Available | 5892 | Open in IMG/M |
| 3300008108|Ga0114341_10053881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2603 | Open in IMG/M |
| 3300008110|Ga0114343_1015596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3504 | Open in IMG/M |
| 3300008110|Ga0114343_1035345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2719 | Open in IMG/M |
| 3300008110|Ga0114343_1063725 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
| 3300008113|Ga0114346_1057961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1901 | Open in IMG/M |
| 3300008261|Ga0114336_1360971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 517 | Open in IMG/M |
| 3300008962|Ga0104242_1023682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1058 | Open in IMG/M |
| 3300008996|Ga0102831_1078479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1101 | Open in IMG/M |
| 3300009026|Ga0102829_1026960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1664 | Open in IMG/M |
| 3300009026|Ga0102829_1197555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 653 | Open in IMG/M |
| 3300009049|Ga0102911_1122243 | Not Available | 742 | Open in IMG/M |
| 3300009050|Ga0102909_1089700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 749 | Open in IMG/M |
| 3300009056|Ga0102860_1137240 | Not Available | 689 | Open in IMG/M |
| 3300009080|Ga0102815_10838102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 524 | Open in IMG/M |
| 3300009152|Ga0114980_10025125 | Not Available | 3701 | Open in IMG/M |
| 3300009152|Ga0114980_10383522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 808 | Open in IMG/M |
| 3300009158|Ga0114977_10443151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 718 | Open in IMG/M |
| 3300009159|Ga0114978_10154654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1475 | Open in IMG/M |
| 3300009159|Ga0114978_10322737 | Not Available | 940 | Open in IMG/M |
| 3300009160|Ga0114981_10743947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 518 | Open in IMG/M |
| 3300009161|Ga0114966_10434137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 761 | Open in IMG/M |
| 3300009161|Ga0114966_10543985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 655 | Open in IMG/M |
| 3300009181|Ga0114969_10018231 | All Organisms → Viruses → Predicted Viral | 4990 | Open in IMG/M |
| 3300009181|Ga0114969_10719395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 536 | Open in IMG/M |
| 3300009194|Ga0114983_1031467 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300009419|Ga0114982_1030946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1737 | Open in IMG/M |
| 3300009419|Ga0114982_1040841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1481 | Open in IMG/M |
| 3300010312|Ga0102883_1155199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 654 | Open in IMG/M |
| 3300010312|Ga0102883_1179161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 602 | Open in IMG/M |
| 3300010374|Ga0114986_1057832 | Not Available | 701 | Open in IMG/M |
| 3300010388|Ga0136551_1000674 | Not Available | 9353 | Open in IMG/M |
| 3300011268|Ga0151620_1013141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2936 | Open in IMG/M |
| 3300011268|Ga0151620_1096075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 938 | Open in IMG/M |
| 3300012000|Ga0119951_1000236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40167 | Open in IMG/M |
| 3300012012|Ga0153799_1043036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 843 | Open in IMG/M |
| 3300012667|Ga0157208_10002873 | Not Available | 3196 | Open in IMG/M |
| 3300012667|Ga0157208_10003689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2673 | Open in IMG/M |
| 3300012719|Ga0157600_1063142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 889 | Open in IMG/M |
| 3300012772|Ga0138287_1011657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 571 | Open in IMG/M |
| 3300013004|Ga0164293_10575787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 734 | Open in IMG/M |
| 3300013295|Ga0170791_10753177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 672 | Open in IMG/M |
| 3300013372|Ga0177922_10622117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 644 | Open in IMG/M |
| 3300017766|Ga0181343_1023663 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300017785|Ga0181355_1021309 | Not Available | 2822 | Open in IMG/M |
| 3300017785|Ga0181355_1298103 | Not Available | 606 | Open in IMG/M |
| 3300019784|Ga0181359_1069940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1331 | Open in IMG/M |
| 3300019784|Ga0181359_1086323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1168 | Open in IMG/M |
| 3300020048|Ga0207193_1221625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1466 | Open in IMG/M |
| 3300020141|Ga0211732_1033768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 679 | Open in IMG/M |
| 3300020141|Ga0211732_1040256 | Not Available | 2440 | Open in IMG/M |
| 3300020141|Ga0211732_1167385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 930 | Open in IMG/M |
| 3300020141|Ga0211732_1371119 | Not Available | 9683 | Open in IMG/M |
| 3300020151|Ga0211736_10145324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 742 | Open in IMG/M |
| 3300020205|Ga0211731_10282787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 848 | Open in IMG/M |
| 3300020498|Ga0208050_1003120 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
| 3300020519|Ga0208223_1005388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2293 | Open in IMG/M |
| 3300020565|Ga0208718_1000372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8124 | Open in IMG/M |
| 3300021519|Ga0194048_10007053 | Not Available | 5276 | Open in IMG/M |
| 3300021519|Ga0194048_10062159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1483 | Open in IMG/M |
| 3300021961|Ga0222714_10186974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1207 | Open in IMG/M |
| 3300021961|Ga0222714_10575066 | Not Available | 566 | Open in IMG/M |
| 3300021962|Ga0222713_10026874 | All Organisms → Viruses → Predicted Viral | 4713 | Open in IMG/M |
| 3300021962|Ga0222713_10070198 | Not Available | 2593 | Open in IMG/M |
| 3300023174|Ga0214921_10006379 | All Organisms → Viruses | 16205 | Open in IMG/M |
| 3300023174|Ga0214921_10016496 | Not Available | 8305 | Open in IMG/M |
| 3300023174|Ga0214921_10019147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7434 | Open in IMG/M |
| 3300023174|Ga0214921_10021916 | Not Available | 6753 | Open in IMG/M |
| 3300023184|Ga0214919_10027805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6007 | Open in IMG/M |
| 3300023184|Ga0214919_10146018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1888 | Open in IMG/M |
| 3300024343|Ga0244777_10046330 | All Organisms → Viruses → Predicted Viral | 2779 | Open in IMG/M |
| 3300024343|Ga0244777_10261188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1100 | Open in IMG/M |
| 3300024343|Ga0244777_10324619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 968 | Open in IMG/M |
| 3300024343|Ga0244777_10585593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 677 | Open in IMG/M |
| 3300024346|Ga0244775_10001871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23645 | Open in IMG/M |
| 3300024346|Ga0244775_10058891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3323 | Open in IMG/M |
| 3300024346|Ga0244775_10111939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2316 | Open in IMG/M |
| 3300024346|Ga0244775_10270248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1414 | Open in IMG/M |
| 3300024346|Ga0244775_10309532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1308 | Open in IMG/M |
| 3300024346|Ga0244775_10337246 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300024346|Ga0244775_10344390 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300024346|Ga0244775_10584480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 908 | Open in IMG/M |
| 3300024348|Ga0244776_10072942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2618 | Open in IMG/M |
| 3300024348|Ga0244776_10094879 | All Organisms → Viruses → Predicted Viral | 2239 | Open in IMG/M |
| 3300024348|Ga0244776_10194866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
| 3300025091|Ga0209616_1025023 | Not Available | 605 | Open in IMG/M |
| 3300025171|Ga0209104_1013341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 658 | Open in IMG/M |
| 3300027133|Ga0255070_1021542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1067 | Open in IMG/M |
| 3300027138|Ga0255064_1025251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1002 | Open in IMG/M |
| 3300027196|Ga0208438_1067812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 582 | Open in IMG/M |
| 3300027203|Ga0208925_106961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 825 | Open in IMG/M |
| 3300027206|Ga0208023_1022276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1097 | Open in IMG/M |
| 3300027212|Ga0208554_1000986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4735 | Open in IMG/M |
| 3300027212|Ga0208554_1011046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1457 | Open in IMG/M |
| 3300027219|Ga0208167_1032804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 920 | Open in IMG/M |
| 3300027247|Ga0208679_1055657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 735 | Open in IMG/M |
| 3300027571|Ga0208897_1155492 | Not Available | 564 | Open in IMG/M |
| 3300027581|Ga0209651_1026752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1791 | Open in IMG/M |
| 3300027581|Ga0209651_1044671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1331 | Open in IMG/M |
| 3300027586|Ga0208966_1003729 | All Organisms → Viruses → Predicted Viral | 4653 | Open in IMG/M |
| 3300027659|Ga0208975_1017770 | All Organisms → Viruses → Predicted Viral | 2363 | Open in IMG/M |
| 3300027689|Ga0209551_1117283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 851 | Open in IMG/M |
| 3300027689|Ga0209551_1233921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 555 | Open in IMG/M |
| 3300027710|Ga0209599_10002364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7842 | Open in IMG/M |
| 3300027710|Ga0209599_10031202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1447 | Open in IMG/M |
| 3300027710|Ga0209599_10037543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1301 | Open in IMG/M |
| 3300027733|Ga0209297_1048593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1921 | Open in IMG/M |
| 3300027733|Ga0209297_1233889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 712 | Open in IMG/M |
| 3300027734|Ga0209087_1172809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 850 | Open in IMG/M |
| 3300027754|Ga0209596_1005929 | Not Available | 8933 | Open in IMG/M |
| 3300027769|Ga0209770_10024129 | All Organisms → Viruses → Predicted Viral | 2664 | Open in IMG/M |
| 3300027770|Ga0209086_10138546 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300027782|Ga0209500_10062850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1937 | Open in IMG/M |
| 3300027782|Ga0209500_10165539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1027 | Open in IMG/M |
| 3300027797|Ga0209107_10057238 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300027797|Ga0209107_10320889 | Not Available | 723 | Open in IMG/M |
| 3300027797|Ga0209107_10449069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 580 | Open in IMG/M |
| 3300027836|Ga0209230_10258429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1004 | Open in IMG/M |
| 3300027892|Ga0209550_10076540 | Not Available | 2582 | Open in IMG/M |
| 3300027892|Ga0209550_10316895 | Not Available | 996 | Open in IMG/M |
| 3300027892|Ga0209550_10764310 | Not Available | 547 | Open in IMG/M |
| 3300028025|Ga0247723_1000641 | Not Available | 23057 | Open in IMG/M |
| 3300028025|Ga0247723_1012236 | Not Available | 3235 | Open in IMG/M |
| 3300028025|Ga0247723_1014414 | Not Available | 2882 | Open in IMG/M |
| 3300028025|Ga0247723_1045453 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300028027|Ga0247722_10003928 | Not Available | 7222 | Open in IMG/M |
| 3300032092|Ga0315905_10003501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16187 | Open in IMG/M |
| 3300033992|Ga0334992_0005392 | Not Available | 9155 | Open in IMG/M |
| 3300033996|Ga0334979_0006466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8198 | Open in IMG/M |
| 3300034019|Ga0334998_0330029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 896 | Open in IMG/M |
| 3300034021|Ga0335004_0326668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 896 | Open in IMG/M |
| 3300034066|Ga0335019_0063557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2509 | Open in IMG/M |
| 3300034095|Ga0335022_0600461 | Not Available | 556 | Open in IMG/M |
| 3300034102|Ga0335029_0003158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13083 | Open in IMG/M |
| 3300034106|Ga0335036_0361139 | Not Available | 945 | Open in IMG/M |
| 3300034109|Ga0335051_0267916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 836 | Open in IMG/M |
| 3300034118|Ga0335053_0480103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 737 | Open in IMG/M |
| 3300034167|Ga0335017_0352999 | Not Available | 807 | Open in IMG/M |
| 3300034200|Ga0335065_0384095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 865 | Open in IMG/M |
| 3300034284|Ga0335013_0536378 | Not Available | 694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 26.22% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.56% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.11% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.22% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.22% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.78% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.78% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.44% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.44% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.44% |
| Stentor Amethystinus | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus | 0.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.44% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.44% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559019 | Stentor MTG 1 | Environmental | Open in IMG/M |
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025171 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
| 3300027203 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| stn_00037690 | 2166559019 | Stentor Amethystinus | MYDLIGSLIAIVLIGFLFAPIVLAVYMWNGAKFDNDNDGKDDLPNRW |
| 2199951921 | 2199352004 | Freshwater | MMYDILGSLIGILLIAFLFSPIVLAVYMWNGAKFDNDNDGKDDLPNRW |
| 2199990787 | 2199352004 | Freshwater | MYDVIGSVIGIILIAFLCSPLVLAVYMWRGAKIDSDNDGKDDVPYRWEKQ |
| JGI12547J11936_10133502 | 3300000736 | Freshwater And Sediment | MTDMIGSVIAIILIAFLCSPIVLATYVWRGAKVDNNHDGKDDVPYRWEQE* |
| JGI12421J11937_100142872 | 3300000756 | Freshwater And Sediment | MYDVIGSILGIGLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW* |
| JGI12421J11937_101401892 | 3300000756 | Freshwater And Sediment | MTDLFGSVIAIILIAFXCSPVVLAVYMWRGIKIDNDXDGKDDVPYRWENK* |
| B570J14230_100725561 | 3300001282 | Freshwater | MYDILGSLIGILLIAFLFSPIVLAVYMWNGAKFDNDNDGKDDLPNRW* |
| RCM33_10002234 | 3300001838 | Marine Plankton | MYTVLGDLIGIILILFLCSPIILAVYMWNSAKIDIDKDGKEDLPNRWNK* |
| RCM34_10759181 | 3300001843 | Marine Plankton | YTVLGDLIGIILILFLCSPIILAVYMWNSAKIDIDKDGKEDLPNRWNK* |
| B570J29579_1028041 | 3300002272 | Freshwater | MYDILGSTIAIILIAFLCSPIVLAIYMWNGAKFDGDNDGQEDLPN |
| B570J40625_10000017966 | 3300002835 | Freshwater | MYDVIGSVIGIILIAFLCSPIVLAVYMWRGAKIDSDNDGKDDVPYRWEKQ* |
| B570J40625_10001563011 | 3300002835 | Freshwater | MYDILGSTIAIILIAFLCSPIVLAIYMWNGAKFDGDNDGQEDLPNRWDKE* |
| JGI25908J49247_101164062 | 3300003277 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWENK* |
| JGI25910J50241_100098855 | 3300003388 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWEKQ* |
| JGI25922J50271_100257365 | 3300003413 | Freshwater Lake | MTDLFGSLIAIILILFLCSPIVLAVYMWNTAKVDIDDDGKEDLPNRWN* |
| JGI25922J50271_100353322 | 3300003413 | Freshwater Lake | MYDILGSAIAIILIAFLCSPIVLAIYMWNGAKFDGDNDGQEDLPNRWDKE* |
| JGI25922J50271_100378922 | 3300003413 | Freshwater Lake | MIDILGSLIGIILICFLCSPIVLAVYMWNGAKIDNDGDGKEDLPNRWDR* |
| JGI25922J50271_100679581 | 3300003413 | Freshwater Lake | MIDIIGSVVAIILIAFLCSPIVLAVYMWNGAKIDSDGDGKEDLPNRWDK* |
| JGI25922J50271_100882412 | 3300003413 | Freshwater Lake | MYDVIGSVIGIILIAFLCSPLVLAVYMWRGAKIDSDNDGKDDVPYRWEKQ* |
| JGI25922J50271_101393381 | 3300003413 | Freshwater Lake | MTDMIGSAIAILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE* |
| JGI25914J50564_100133791 | 3300003429 | Freshwater Lake | MYDVIGSILGICLIAFLCSPLVLAVYMWNGAKFDDDNDGIEDLPNRW* |
| JGI25924J51412_10277082 | 3300003491 | Freshwater Lake | MYDVIGSVIGIILIAFLCSPLVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ* |
| JGI25923J51411_10136063 | 3300003493 | Freshwater Lake | MYDVIGSAIGIILILFLCSPILLAVYMWTTGKVDIDHDGQEDLPNRWDR* |
| JGI25923J51411_10235192 | 3300003493 | Freshwater Lake | MTELIGSVIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| JGI25923J51411_10470881 | 3300003493 | Freshwater Lake | MYDILGSAIAIILIAFLCSPIVLAIYMWNGAKFDXDHDGQEDLPNRWNR* |
| JGI25930J51415_10793911 | 3300003499 | Freshwater Lake | MYDILGSXIAIILIAFLCSPIVLAIYMWNGAKFDGDNXGQXDLPNRWDKE* |
| Ga0063232_100504423 | 3300004054 | Freshwater Lake | MTDTIGALIGIVLILFLCSPIMLAVYMWVNAKTDVDSDLKEDLPNRWSK* |
| Ga0063232_101446432 | 3300004054 | Freshwater Lake | MYEVLGSVIGILLILALCSPIILAVYMWNTGKIDIDKDGKEDLPNRWGG* |
| Ga0065166_105048332 | 3300004112 | Freshwater Lake | IGAVIAIILILFLCSPIVLAVYMWNAAKIDIDNDGVEDLPNRW* |
| Ga0070374_105017001 | 3300005517 | Freshwater Lake | MYDILGSAIAIILIAFLCSPIVLAIYMWNGAKFDNDHDGQEDLPNRWNR* |
| Ga0049083_102275202 | 3300005580 | Freshwater Lentic | MTDLFGSVIAIILIAFLCSPIALAVYMWRGSKIDNDNDGKDDLPYRWNK* |
| Ga0049081_102525102 | 3300005581 | Freshwater Lentic | MIGSVIAIILIAFLCSPIVLAVYMWTNVKIDNDHDGKEDLPNRWSK* |
| Ga0078894_101870892 | 3300005662 | Freshwater Lake | MIDVIGAVIAIILILFLCSPIVLAVYMWNAAKIDIDNDGVEDLPNRW* |
| Ga0078894_108224562 | 3300005662 | Freshwater Lake | MTDLIGSMIAIILIAFLFSPIVLAMYMWAGAKIDIDQDGKEDLPNRW* |
| Ga0078894_111328762 | 3300005662 | Freshwater Lake | MIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWE |
| Ga0078894_117569271 | 3300005662 | Freshwater Lake | IAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE* |
| Ga0070743_102261362 | 3300005941 | Estuarine | MYDIFGSLIGIILICFLCSPIILAVYMWNTAKIDNDNDGKEDLPNRWDR* |
| Ga0070743_102418762 | 3300005941 | Estuarine | MTELIGSAIAIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEKQ* |
| Ga0070744_100080597 | 3300006484 | Estuarine | MYDVIGSVIAIILISFLCSPVVLAVYMWRSVKIDNDHDGKDDVPNRW* |
| Ga0070744_100094379 | 3300006484 | Estuarine | MYDVIGSILGICLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW* |
| Ga0070744_100664823 | 3300006484 | Estuarine | MTDTIGALIGIVLILFLCSPIMLAVYMWVNAKTDVDSDLKEDLPNRWRK* |
| Ga0070744_100714972 | 3300006484 | Estuarine | MTDMIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE* |
| Ga0070744_102380612 | 3300006484 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEKQ* |
| Ga0075471_106162282 | 3300006641 | Aqueous | MIDVFGSLIAIILILFLCSPIMLAVFMWNTAKIDIDKDGQEDLPNRWNK* |
| Ga0102861_10118491 | 3300007544 | Estuarine | MTELIGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWENK* |
| Ga0102873_10793512 | 3300007545 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEK* |
| Ga0102875_11175583 | 3300007547 | Estuarine | MTELIGSAIAIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEK* |
| Ga0102875_11391892 | 3300007547 | Estuarine | MIDIVGSVIAIILIAFLCSPIVLAVYMWNGAKIDSDNDGKEDLPNRWSK* |
| Ga0102877_10950032 | 3300007548 | Estuarine | MTDLFGSVIAIILIAFLCSPIVLAVYMWTSVRIDNDHDGKEDLPNR |
| Ga0102879_10478132 | 3300007549 | Estuarine | MADLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEK* |
| Ga0102879_10690182 | 3300007549 | Estuarine | MTELIGSVIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWENK* |
| Ga0102880_11781461 | 3300007550 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWENK* |
| Ga0102881_10634063 | 3300007551 | Estuarine | MTELIGSAIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0102819_10146351 | 3300007553 | Estuarine | MTDLIGSVIAIILIALLCSPVMLAVYMWRGIKIDNDH |
| Ga0102817_11334411 | 3300007555 | Estuarine | MIDILGSLIGIILICFLCSPIVLAVYMWNGAKIDSDGDGKEDLPNRWDR* |
| Ga0102913_12554961 | 3300007560 | Estuarine | MIDIVGSVIAIILIAFLCSPIVLAVYMWNGAKIDSDND |
| Ga0102915_10521733 | 3300007562 | Estuarine | MTDLIGSVIGIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0102917_10563205 | 3300007590 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0102919_12055591 | 3300007597 | Estuarine | MMYDWIGSIIAIILIGFLCSPIVLAVYMWNAAKIDIDNDGKEDLPNRWS* |
| Ga0102920_11740962 | 3300007600 | Estuarine | MTELIGSAIAIILIAFLCTPVVLAVYMWRVAKIDNDHDGKDDVPYRWEK |
| Ga0102897_11088222 | 3300007617 | Estuarine | MTELIGSAIAIILIAFLCTPVVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ* |
| Ga0102896_12524172 | 3300007618 | Estuarine | MMYDILGSLIGIILIVFLCSPILLAMYMWNSAKIDIDKDGKEDLPNRWDR* |
| Ga0102896_12668522 | 3300007618 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEKQ* |
| Ga0102871_10458852 | 3300007620 | Estuarine | MTELIGSAIAIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEKQ* |
| Ga0102871_10466553 | 3300007620 | Estuarine | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGVKIDNDHDGKDDVPYRWEK |
| Ga0102871_10532484 | 3300007620 | Estuarine | IGSILAIGLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW* |
| Ga0102878_10741003 | 3300007624 | Estuarine | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGAKIDNDHDGKDDVPYRWENK* |
| Ga0102895_12062181 | 3300007629 | Estuarine | MIDIVGSVIAIILIAFLCSPIVLAVYMWNGAKIDSDGDGKEDLPNRWDR* |
| Ga0102903_11835001 | 3300007630 | Estuarine | MTDMIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEK* |
| Ga0102901_11046321 | 3300007634 | Estuarine | LIAFLCSPLVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0102901_11601472 | 3300007634 | Estuarine | MTELIGSAIAIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEKE* |
| Ga0102856_10821052 | 3300007636 | Estuarine | MTDLIGSVIAIILIVFLCTPVVLAVYMWRGAKIDND |
| Ga0102876_11347182 | 3300007642 | Estuarine | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGVKIDNDHDGKDDVPYRWE |
| Ga0102855_11239762 | 3300007647 | Estuarine | MTDMIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVSYRWEKE* |
| Ga0102912_10628091 | 3300007649 | Estuarine | MYDVLGSLIGIILILFLCSPIMLAMYMWNSGKIDIDKDGKEDLPNRWDR* |
| Ga0102866_11639401 | 3300007661 | Estuarine | MYDVLCSIIGIILIAFLCSPLVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ* |
| Ga0102823_11944151 | 3300007692 | Estuarine | MYEVIGSLIGIVLILFLCSPIMLAVYMWRGAKIDNDHDGKDDVPCRWEKQ* |
| Ga0102859_10624673 | 3300007708 | Estuarine | MIDIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDSDYDGKEDLPNRWSK* |
| Ga0102859_12801832 | 3300007708 | Estuarine | MMYDILGSLIGILLIAFLFSPIVLAVYMWNGAKFDNDNDGKDDLPNRW* |
| Ga0105739_10100941 | 3300007954 | Estuary Water | MTDMIGSAIAIILIAFLCSPLVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ* |
| Ga0105748_102232682 | 3300007992 | Estuary Water | MYDVIGSLIGIVLIAFLCSPIVLSVYMWRGAKIDNDHDGKDDVPYRWEKK* |
| Ga0105748_102544253 | 3300007992 | Estuary Water | DLIGSAIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0105748_105023651 | 3300007992 | Estuary Water | MTDLVGSVIAIILIAFLCSPVMLAVYMWRGIKIDNDHDGKDDVPYRWEKQ* |
| Ga0102893_11426843 | 3300008052 | Estuarine | IGSAIAIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEK* |
| Ga0114340_10264195 | 3300008107 | Freshwater, Plankton | MTDTIGALIGVLLILFLCSPIMLAVYMWVNAKTDIDSDLKEDLPNRWSK* |
| Ga0114341_1002128313 | 3300008108 | Freshwater, Plankton | MTDLIGSLIGIILILFLCSPLALAVYILNATNIDIDEDGKHDVPYRWEQE* |
| Ga0114341_100538811 | 3300008108 | Freshwater, Plankton | MTDMIGSAIGILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEQE* |
| Ga0114343_101559613 | 3300008110 | Freshwater, Plankton | MTDLIGSLIGIILILFLCSPLVLAVYMWRGAKIDSDNDGKDDVPYRWEKQ* |
| Ga0114343_10353451 | 3300008110 | Freshwater, Plankton | MTDLFGSVIAILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKQ* |
| Ga0114343_10637254 | 3300008110 | Freshwater, Plankton | MTDMIGSSIAILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE* |
| Ga0114346_10579613 | 3300008113 | Freshwater, Plankton | MTDMIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEQE* |
| Ga0114336_13609711 | 3300008261 | Freshwater, Plankton | MTDIVGSVIAVLLIGFLCSPIMLAVYMWRSVKIDIDK |
| Ga0104242_10236821 | 3300008962 | Freshwater | MYDILGSLIGIILICFLCSPIVLAIYMWMNAESDIDNDGKKDLPNRWEKK* |
| Ga0102831_10784792 | 3300008996 | Estuarine | MTDLIGSAIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0102829_10269601 | 3300009026 | Estuarine | MTDLIGSVIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0102829_11975552 | 3300009026 | Estuarine | MTELIGSVIAIILIAFLCTPVVLAVYMWRGAKIDNDHD |
| Ga0102911_11222431 | 3300009049 | Estuarine | MTDLIGSAIAIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEK* |
| Ga0102909_10897002 | 3300009050 | Estuarine | MTDLFGSVIAIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEKQ* |
| Ga0102860_11372403 | 3300009056 | Estuarine | MTELIGSAIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVTYSWEKQ* |
| Ga0102815_108381022 | 3300009080 | Estuarine | MYDIFGSLIGIILICFLCSPIVLAVYMWNGAKIDNDGDG |
| Ga0114980_100251252 | 3300009152 | Freshwater Lake | MYDILGSLIGIILICFLCSPIVLAIYMWTHAESDIDNDGKKDLPNRWDR* |
| Ga0114980_103835222 | 3300009152 | Freshwater Lake | MYDLIGSLIGIVLIAFLCSPIVLAVYMWNGAKFDHDNDGKDDLPNRW* |
| Ga0114977_104431512 | 3300009158 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDNDGKDDVPYRWEKK* |
| Ga0114978_101546543 | 3300009159 | Freshwater Lake | MTDLIGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWEKQ* |
| Ga0114978_103227371 | 3300009159 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWEKK* |
| Ga0114981_107439471 | 3300009160 | Freshwater Lake | MYDLIGSAIAILLIAFLCSPIVLAVYMWNGAKFDHDNDGKDDLPNRW* |
| Ga0114966_104341372 | 3300009161 | Freshwater Lake | MYDVIGSLIGIILIGFLCSPIVLAIYMWTNAESDIDNDGKKDLPNRWEKQ* |
| Ga0114966_105439851 | 3300009161 | Freshwater Lake | MIDILGSLIGIILIAFLCSPIVLAVYMWTSVKIDNDHDGKEDLPNRWSK* |
| Ga0114969_100182313 | 3300009181 | Freshwater Lake | MTDLFGSVIAIILITFLCSPIALAVYMWRGSKIDNDNDGKDDLPYRWNK* |
| Ga0114969_107193951 | 3300009181 | Freshwater Lake | MYDVIGSLIGIILIGFLCSPIVLAIYMWTNAESDIDND |
| Ga0114983_10314671 | 3300009194 | Deep Subsurface | MTDMIGSIIAIILIAFLCSPIVLAVYVWRGAKVDNNHDGKDDVPYRWDKG* |
| Ga0114982_10309464 | 3300009419 | Deep Subsurface | MTDMIGSVIAIILIGFLCSPILLVVYMWRGAKIDIDNDGKDDVPYRWEKQ* |
| Ga0114982_10408413 | 3300009419 | Deep Subsurface | MYDLIGSMIAIVLIGFLCSPIVLVVYMWRGAKIDNDNDGKDDVPYRWEKQ* |
| Ga0102883_11551992 | 3300010312 | Estuarine | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGVKIDNDHDGKDDVPYRWEKQ* |
| Ga0102883_11791612 | 3300010312 | Estuarine | MTDLFGSVIAIILIAFLCSPIVLAVYMWNGAKIDSDNDGKEDLPNRWSK* |
| Ga0114986_10578321 | 3300010374 | Deep Subsurface | MIGSIIAIILIAFLCSPIVLAVYVWRGAKVDNNHDGKDDVPYRWDKG* |
| Ga0136551_100067414 | 3300010388 | Pond Fresh Water | MIDVIGSLIAIMLILFLCSPIILAVYMWNAAKVDVDNDGKEDLPNRW* |
| Ga0151620_10131416 | 3300011268 | Freshwater | MTDLIGSVIAIILIAFLCTPVALAVYMWRGAKIDNDHDGKDDVPYRWEKQ* |
| Ga0151620_10960752 | 3300011268 | Freshwater | MMYDIIGSILGIGLIAFLCSPIVLAVYMWNGAKFDNDNDGKDDLPNRW* |
| Ga0119951_10002363 | 3300012000 | Freshwater | MYDILGSLIGIILICLLCSPIVLAIYMWTHAESDIDNDGKKDLPNRWDR* |
| Ga0153799_10430362 | 3300012012 | Freshwater | MTDMIGSAIAIILIAFLCSPVVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ* |
| Ga0157208_100028737 | 3300012667 | Freshwater | MYDVIGSVIGILLILSLCSPIILAVYMWNTAKIDIDKDGKEDLPNRWDR* |
| Ga0157208_100036894 | 3300012667 | Freshwater | MYDLIGALIGIVLILFLCSPIMLAVYMWNTAKIDIDKDGKEDLPNRWDR* |
| Ga0157600_10631421 | 3300012719 | Freshwater | MYDVIGSVIGIILIAFLCSPLVLAVYMWRGAKIDSDND |
| Ga0138287_10116571 | 3300012772 | Freshwater Lake | MYDILGSAIAIILIAFLCSPNVLAIYMWNGAKFDNDHDGQEDLPNRWNR* |
| Ga0164293_105757872 | 3300013004 | Freshwater | MIDIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDNDGDGKEDLPNRWDK* |
| Ga0170791_107531772 | 3300013295 | Freshwater | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDNDG |
| Ga0177922_106221172 | 3300013372 | Freshwater | MTDMIGSVIAIILIAFLCSPIVLAVYMWTNVKIDNDHDGKEDLPNRWSK* |
| Ga0181343_10236633 | 3300017766 | Freshwater Lake | MTDMIGSAIGILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEQE |
| Ga0181355_10213094 | 3300017785 | Freshwater Lake | MTELIGSVIAIILIAFLCTPVVLAVYMWRGIKIDNDHDGKDDVPYRWENK |
| Ga0181355_12981033 | 3300017785 | Freshwater Lake | SILGIGLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW |
| Ga0181359_10699402 | 3300019784 | Freshwater Lake | MYDVIGSILGICLIAFLCSPLVLAVYMWNGAKFDDDNDGIEDLPNRW |
| Ga0181359_10863231 | 3300019784 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWENK |
| Ga0207193_12216254 | 3300020048 | Freshwater Lake Sediment | MIDILGSLIGIILICFLCSPIVLAVYMWNGAKIDNDGDGKEDLPNRWDR |
| Ga0211732_10337682 | 3300020141 | Freshwater | MTTDLIGSVIAIILIAFLCTPVLLAVYMWRGAKIDNDHDGKDDVPYRWEKQ |
| Ga0211732_10402562 | 3300020141 | Freshwater | MIDIVGSVIAIILIGFLCSPIVLAVYMWNTAKIDSDNDGKEDLPNRWSK |
| Ga0211732_11673852 | 3300020141 | Freshwater | MYDVIGSLIGIILIAFLCSPLVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ |
| Ga0211732_13711196 | 3300020141 | Freshwater | MTDLFGSVIAIILIGFLCSPIVLAVYMWNTAKIDNDNDGKDDLPYRWNK |
| Ga0211736_101453242 | 3300020151 | Freshwater | MIGSVIAIILIGFLCSPILLAVYMWRGVKVDNDHDGKDDVPYRWDKT |
| Ga0211731_102827871 | 3300020205 | Freshwater | MYDLIGSLIAIVLIGFLFAPIVLAVYMWNGAKFDDDNDGIEDLPNRWS |
| Ga0208050_10031205 | 3300020498 | Freshwater | MYDILGSTIAIILIAFLCSPIVLAIYMWNGAKFDGDNDGQEDLPNRWDKE |
| Ga0208223_10053886 | 3300020519 | Freshwater | MTDMIGSVIAIILIAFLCSPIVLAVYMWRGAKVDNDHDGKDDVPYRWEKQ |
| Ga0208718_10003721 | 3300020565 | Freshwater | MYDILGSLIGILLIAFLFSPIVLAVYMWNGAKFDNDNDGKDDLPNRW |
| Ga0194048_1000705313 | 3300021519 | Anoxic Zone Freshwater | MIDILGSLIGIILIAFLCSPIVLAVYMWTSVKIDNDHDGKEDLPNRWSK |
| Ga0194048_100621592 | 3300021519 | Anoxic Zone Freshwater | MTDLLGSVIAIILIAFLCSPVVLAVYMWRAIKIDNDHDGKDDVPYRWENK |
| Ga0222714_101869741 | 3300021961 | Estuarine Water | MTDLIGSLIGILLILFLCSPIMLAVYMWRGAKIDIDKDGKEDLPNRW |
| Ga0222714_105750661 | 3300021961 | Estuarine Water | TDTIGALIGVLLILFLCSPIMLAVYMWVNAKTDIDSDLKEDLPNRWSK |
| Ga0222713_100268741 | 3300021962 | Estuarine Water | MTDLIGSVIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ |
| Ga0222713_100701985 | 3300021962 | Estuarine Water | MTDTIGALIGVLLILFLCSPIMLAVYMWVNAKTDIDSDLKEDLPNRWSK |
| Ga0214921_1000637932 | 3300023174 | Freshwater | MYDVIGSLIGIILICFLCSPIVLAIYMWRGMKIDNDHDGKDDVPYRWEKK |
| Ga0214921_1001649620 | 3300023174 | Freshwater | MTDVIGSLIGIILIGFLCSPIILAVYMWNSVKIDFDNDGKDDVPNRWNR |
| Ga0214921_1001914722 | 3300023174 | Freshwater | MYDVLGSLIGIVLILFLCSPIMLAVYMWRGAKIDIDNDGKEDLPNRW |
| Ga0214921_100219164 | 3300023174 | Freshwater | MTDVIGSLIGIVLIFFLCSPIVLAVYMLSSSKVDIDGDGIDDVPNRWDNT |
| Ga0214919_1002780513 | 3300023184 | Freshwater | MYDILGSLIGIILICLLCSPIVLAIYMWTHAESDIDNDGKKDLPNRWDR |
| Ga0214919_101460184 | 3300023184 | Freshwater | MIDILGSLIGIILICFLCSPIILAVYMWNTAKIDIDKDGKEDLPNRWNR |
| Ga0244777_100463304 | 3300024343 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVP |
| Ga0244777_102611882 | 3300024343 | Estuarine | MIDIVGSVIAIILIAFLCSPIVLAVYMWNGAKIDSDNDGKEDLPNRWSK |
| Ga0244777_103246191 | 3300024343 | Estuarine | MTELIGSAIAIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEKQ |
| Ga0244777_105855931 | 3300024343 | Estuarine | MTDMIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE |
| Ga0244775_1000187135 | 3300024346 | Estuarine | MYDVIGSILGICLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW |
| Ga0244775_100588914 | 3300024346 | Estuarine | MYDVIGSVIAIILISFLCSPVVLAVYMWRSVKIDNDHDGKDDVPNRW |
| Ga0244775_101119395 | 3300024346 | Estuarine | MYEVIGSLIGIVLILFLCSPIMLAVYMWRGAKIDIDNDGKEDLPNRW |
| Ga0244775_102702482 | 3300024346 | Estuarine | MYDLIGSLIGILLIGFLCSPIVLAVYMWNNAKIDNDNDGKEDLPNRW |
| Ga0244775_103095321 | 3300024346 | Estuarine | MIDILGSLIGIILICFLCSPIVLAVYMWNGAKIDSDGDGKEDLPNRWDR |
| Ga0244775_103372462 | 3300024346 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWCGTKVDNDHDGKDDVPYRWEKQ |
| Ga0244775_103443903 | 3300024346 | Estuarine | MTDTIGALIGIVLILFLCSPIMLAVYMWVNAKTDVDSDLKEDLPNRWRK |
| Ga0244775_105844802 | 3300024346 | Estuarine | MYDVLGSVIAIGLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW |
| Ga0244776_100729424 | 3300024348 | Estuarine | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGVKIDNDHDGKDDVPYRWEKQ |
| Ga0244776_100948791 | 3300024348 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEK |
| Ga0244776_101948661 | 3300024348 | Estuarine | MTDLFGSVIAIILIAFLCSPIALAVYMWRGSKIDNDNDGKDDLPYRWNK |
| Ga0209616_10250232 | 3300025091 | Freshwater | MYDILGSVIGIILIAFLCSPIVLAVYMWTSGKIDTDNDGKEDLPNRW |
| Ga0209104_10133412 | 3300025171 | Freshwater | MYDILGSVIGIILIAFLCSPIVLAVYMWTSGKIDTDNDGKEDL |
| Ga0255070_10215421 | 3300027133 | Freshwater | MTDLIGSAIAIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ |
| Ga0255064_10252512 | 3300027138 | Freshwater | MYDVIGSVIGIILIAFLCSPLVLAVYMWRGAKIDSDNDGK |
| Ga0208438_10678122 | 3300027196 | Estuarine | MTDLIGSVIAIILISFLCSPVVLAVYMWRSVKIDNDHDGKDDVPYRWEKK |
| Ga0208925_1069611 | 3300027203 | Estuarine | MTDMIGSAIAILLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW |
| Ga0208023_10222763 | 3300027206 | Estuarine | MTDMIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWE |
| Ga0208554_100098610 | 3300027212 | Estuarine | MIGSAIAIILIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE |
| Ga0208554_10110464 | 3300027212 | Estuarine | MIDIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDSD |
| Ga0208167_10328042 | 3300027219 | Estuarine | MTDLIGSVIGIILIAFLCTPVVLAVYMWRGAKIDNDHDGKDDVPYRWEKQ |
| Ga0208679_10556571 | 3300027247 | Estuarine | MTDLIGSVIGIILIAFLCTPVLLAVYMWRGIKIDNDHDGKDDVPYRWEKQ |
| Ga0208897_11554921 | 3300027571 | Estuarine | VIGSLIGIVLILFLCSPIMLAVYMWRGAKIDIDNDGKEDLPNRW |
| Ga0209651_10267522 | 3300027581 | Freshwater Lake | MYDVIGSAIGIILILFLCSPILLAVYMWTTGKVDIDHDGQEDLPNRWDR |
| Ga0209651_10446711 | 3300027581 | Freshwater Lake | MYDVIGSILGIGLIAFLCSPIVLAVYMWNGAKFDDDNDGIEDLPNRW |
| Ga0208966_100372919 | 3300027586 | Freshwater Lentic | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWEKQ |
| Ga0208975_10177702 | 3300027659 | Freshwater Lentic | MTDMIGSVIAIILIAFLCSPIVLATYVWRGAKVDNNHDGKDDVPYRWEQE |
| Ga0209551_11172832 | 3300027689 | Freshwater Lake | MTDTIGALIGIVLILFLCSPIMLAVYMWVNAKTDVDSDLKEDLPNRWSK |
| Ga0209551_12339212 | 3300027689 | Freshwater Lake | MIDIIGSVVAIILIAFLCSPIVLAVYMWNGAKIDSDGDGKEDLPNRWDK |
| Ga0209599_100023644 | 3300027710 | Deep Subsurface | MTDMIGSVIAIILIGFLCSPILLVVYMWRGAKIDIDNDGKDDVPYRWEKQ |
| Ga0209599_100312023 | 3300027710 | Deep Subsurface | MYDLIGSMIAIVLIGFLCSPIVLVVYMWRGAKIDNDNDGKDDVPYRWEKQ |
| Ga0209599_100375432 | 3300027710 | Deep Subsurface | MIGSIIAIILIAFLCSPIVLAVYVWRGAKVDNNHDGKDDVPYRWDKG |
| Ga0209297_10485934 | 3300027733 | Freshwater Lake | MYDILGSLIGIILICFLCSPIVLAIYMWTHAESDIDNDGKKDLPNRWDR |
| Ga0209297_12338891 | 3300027733 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDNDGKDDVPYRWEKK |
| Ga0209087_11728092 | 3300027734 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDN |
| Ga0209596_100592918 | 3300027754 | Freshwater Lake | MTDLFGSVIAIILITFLCSPIALAVYMWRGSKIDNDNDGKDDLPYRWNK |
| Ga0209770_1002412910 | 3300027769 | Freshwater Lake | MTDLFGSLIAIILILFLCSPIVLAVYMWNTAKVDIDDDGKEDLPNRWN |
| Ga0209086_101385464 | 3300027770 | Freshwater Lake | ILIAFLCSPIVLAIYMWNGAKFDNDHDGQEDLPNRWNR |
| Ga0209500_100628503 | 3300027782 | Freshwater Lake | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRWEKK |
| Ga0209500_101655392 | 3300027782 | Freshwater Lake | MTDLIGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYRW |
| Ga0209107_100572386 | 3300027797 | Freshwater And Sediment | MTDMIGSVIAIILIAFLCSPIVLAVYMWTNVKIDNDHDGKEDLPNRWSK |
| Ga0209107_103208893 | 3300027797 | Freshwater And Sediment | SAIAIILIAFLCSPLVLAVYMWRGAKIDNDNDGKDDVPYRWEKQ |
| Ga0209107_104490692 | 3300027797 | Freshwater And Sediment | MTDIVGSVIAVLLIGFLCSPIMLAVYMWRSVKIDIDKDGKEDLPNRW |
| Ga0209230_102584291 | 3300027836 | Freshwater And Sediment | MTDLFGSVIAIILIAFLCSPVVLAVYMWRGIKIDNDHDGKDDVPYR |
| Ga0209550_100765402 | 3300027892 | Freshwater Lake | MYEVLGSVIGILLILALCSPIILAVYMWNTGKIDIDKDGKEDLPNRWGG |
| Ga0209550_103168954 | 3300027892 | Freshwater Lake | YDILGSAIAIILIAFLCSPIVLAIYMWNGAKFDNDHDGQEDLPNRWNR |
| Ga0209550_107643102 | 3300027892 | Freshwater Lake | YDILGSAIAIILIAFLCSPIVLAIYMWNGAKFDGDNDGQEDLPNRWDKE |
| Ga0247723_100064157 | 3300028025 | Deep Subsurface Sediment | MIGSVIAIILIGFLCSPILLVVYMWRGAKIDIDNDGKDDVPYRWEKQ |
| Ga0247723_10122368 | 3300028025 | Deep Subsurface Sediment | MTDLIGSIFAIILILFLCSPIILAVYMWNASKIDIDNDGKEDLPNRWNK |
| Ga0247723_10144145 | 3300028025 | Deep Subsurface Sediment | MTDLFGSLIAIILILFLCSPIMLAVYMWNTAKVDIDNDGKEDLPNRWN |
| Ga0247723_10454534 | 3300028025 | Deep Subsurface Sediment | MYDILGSLIGIILIGFLCSPIMLAVYMWNTAKIDNDNDGKEDLPNRWDR |
| Ga0247722_100039285 | 3300028027 | Deep Subsurface Sediment | MTDMIGSIIAIILIAFLCSPIVLAVYVWRGAKVDNNHDGKDDVPYRWDKG |
| Ga0315905_1000350124 | 3300032092 | Freshwater | MIEIIGALIAITLILFLCSPIVLAVYMWNAAKVDTDNDGHEDIPNRW |
| Ga0334992_0005392_5764_5916 | 3300033992 | Freshwater | MTDMIGSAIGILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE |
| Ga0334979_0006466_1395_1544 | 3300033996 | Freshwater | MIDIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDNDGDGKEDLPNRWDK |
| Ga0334998_0330029_776_895 | 3300034019 | Freshwater | MTDMIGSAIAILLIAFLCSPIVLAMYVWRGAKVDNNRDGK |
| Ga0335004_0326668_457_609 | 3300034021 | Freshwater | MTDMIGSAIAILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKQ |
| Ga0335019_0063557_25_174 | 3300034066 | Freshwater | MIDIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDNDGDGKEDLPNRWDR |
| Ga0335022_0600461_1_138 | 3300034095 | Freshwater | GSAIGILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEKE |
| Ga0335029_0003158_4039_4182 | 3300034102 | Freshwater | MTDIVGSLIAIILILFLCSPIVLAMYMWNSAKIDIDKDGKEDLPNRW |
| Ga0335036_0361139_808_945 | 3300034106 | Freshwater | GSAIAILLIAFLCSPIVLAMYVWRGAKVDNNRDGKDDVPYRWEKE |
| Ga0335051_0267916_230_379 | 3300034109 | Freshwater | MTDMIGSAIAILLIAFLCSPIVLAMYVWRGAKVDNNHDGKDDVPYRWEK |
| Ga0335053_0480103_606_737 | 3300034118 | Freshwater | MIDIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDNDGDGKEDLP |
| Ga0335017_0352999_68_220 | 3300034167 | Freshwater | MTDMIGSAIAIILIAFLCSPIVLAVYMWRGAKVDNDHDGKDDVPYRWEKQ |
| Ga0335065_0384095_496_648 | 3300034200 | Freshwater | MTDMIGSAIAILLIAFLCSPIVLAMYVWRGAKVDNNRDGKDDVPYRWEKE |
| Ga0335013_0536378_475_624 | 3300034284 | Freshwater | MINIIGSVIAIILIAFLCSPIVLAVYMWNGAKIDNDGDGKEDLPNRWDK |
| ⦗Top⦘ |