| Basic Information | |
|---|---|
| Taxon OID | 3300003254 Open in IMG/M |
| Scaffold ID | Pfc106_1000033 Open in IMG/M |
| Source Dataset Name | Marine sponge Petrosia ficiformis associated microbial communities from Achziv, Israel - Sample 106 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 41363 |
| Total Scaffold Genes | 51 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (41.18%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge Petrosia Ficiformis Associated → Marine Sponge Petrosia Ficiformis Associated Microbial Communities From Achziv, Israel |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Achziv, Israel | |||||||
| Coordinates | Lat. (o) | 33.01 | Long. (o) | 35.04 | Alt. (m) | Depth (m) | 20 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055778 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Pfc106_100003321 | F055778 | N/A | MLSNVDFPEPELPTIKTISPCSTERVALSRALTLFSPSP* |
| ⦗Top⦘ |