| Basic Information | |
|---|---|
| Taxon OID | 3300003251 Open in IMG/M |
| Scaffold ID | IrcVar142_1001803 Open in IMG/M |
| Source Dataset Name | Ircinia variabilis associated microbial communities from Achziv, Israel - Sample 142 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7313 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Ircinia Variabilis Associated → Ircinia Variabilis Associated Microbial Communities From Achziv, Israel |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Achziv, Israel | |||||||
| Coordinates | Lat. (o) | 33.01 | Long. (o) | 35.04 | Alt. (m) | Depth (m) | 5 to 9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045799 | Metagenome / Metatranscriptome | 152 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| IrcVar142_10018032 | F045799 | N/A | MKKLFLALLFNLITLTAFSQDNFAGWWESKTSKYITMIYVGDYGVSQVVNYNPWNEDVIEERIIRRNKYTFVTHLFNKRNGYSVKIKYKLKDKNNLICKFTGDLKRTVHLTRYKFDLNNKLKT* |
| ⦗Top⦘ |