| Basic Information | |
|---|---|
| Taxon OID | 3300003178 Open in IMG/M |
| Scaffold ID | FcsdDRAFT_1000263 Open in IMG/M |
| Source Dataset Name | 373C |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Marine Microbiology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 29421 |
| Total Scaffold Genes | 44 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 38 (86.36%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Deep-Sea, Bismarck Sea, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -3.721194 | Long. (o) | 151.674553 | Alt. (m) | Depth (m) | 1680 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030996 | Metagenome / Metatranscriptome | 183 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FcsdDRAFT_100026315 | F030996 | AGGAG | MSSTNTLTGKLGKVTVDGSLVARITQWEVRPALANTNEWGDSDSAGYTNRSPGRKDCTFTTEGKFDTTNEVYDLFQPGDSAQVTLWINATLYWDFPSALCTEFSLLVNVDTEEVVGWTASWGADGQFYYPGETGAPVRTLP* |
| ⦗Top⦘ |