3300003178: 373C

Overview

Basic Information

• IMG/M Taxon OID: 3300003178
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111369 | Gp0096880 | Ga0055412
• Sample Name: 373C
• Sequencing Status: Permanent Draft
• Sequencing Center: Max Planck Institute for Marine Microbiology
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 96159472
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine black smoker biome → black smoker → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Deep-Sea, Bismarck Sea, Papua New Guinea
• Coordinates
  • Lat. (^o): -3.721194
  • Long. (^o): 151.674553
  • Alt. (m): N/A
  • Depth (m): 1680

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030996	Metagenome / Metatranscriptome	183	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
FcsdDRAFT_1000263	Not Available	29421

Sequences

Scaffold ID	Protein ID	Family	Sequence
FcsdDRAFT_1000263	FcsdDRAFT_100026315	F030996	MSSTNTLTGKLGKVTVDGSLVARITQWEVRPALANTNEWGDSDSAGYTNRSPGRKDCTFTTEGKFDTTNEVYDLFQPGDSAQVTLWINATLYWDFPSALCTEFSLLVNVDTEEVVGWTASWGADGQFYYPGETGAPVRTLP*