Scaffold Ga0052235_1014797

Overview

Basic Information

• Taxon OID: 3300003147
• Scaffold ID: Ga0052235_1014797
• Source Dataset Name: Planktonic microbial communities from North Pacific Subtropical Gyre
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1717
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location

• Location Name: North Pacific Subtropical Gyre, Hawaii
• Coordinates
  • Lat. (^o): 22.887959
  • Long. (^o): -158.027466

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090259	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052235_10147977	F090259	AGGAG	VKVGKLYEVRHKWLLPHDNREFWSNCGPILYLGEDVIERSDGEHIINHGVLACGEHRILDATFLRLLEPVDEGDQ*