Scaffold Ga0052243_1046011

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052243_1046011

Scaffold Ga0052243_1046011

Overview

Basic Information
Taxon OID	3300003145 Open in IMG/M
Scaffold ID	Ga0052243_1046011 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from deep subseafloor - Sample from 0.8 mbsf
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Japan Agency for Marine-Earth Science and Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	742
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor

Source Dataset Sampling Location
Location Name	Northwestern Pacific Ocean
Coordinates	Lat. (^o)	41.1773	Long. (^o)	142.2013	Alt. (m)		Depth (m)	1180.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024682	Metagenome / Metatranscriptome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052243_10460111	F024682	N/A	NSANNLKHLAQLNLVQWRETLNTEDELISKLKQEIGKALPPMFAGMAENMLESNKDVIIKWLKDNKDLVKEVIES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.