Scaffold Ga0052242_1002342

Overview

Basic Information

• Taxon OID: 3300003142
• Scaffold ID: Ga0052242_1002342
• Source Dataset Name: Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Japan Agency for Marine-Earth Science and Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1445
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor

Source Dataset Sampling Location

• Location Name: Northwestern Pacific Ocean
• Coordinates
  • Lat. (^o): 41.1773
  • Long. (^o): 142.2013
  • Depth (m): 1180.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030288	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052242_10023422	F030288	GGAG	MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLADIII*