Scaffold Ga0052246_1001074

Overview

Basic Information

• Taxon OID: 3300003141
• Scaffold ID: Ga0052246_1001074
• Source Dataset Name: Marine sediment microbial communities from deep subseafloor of Shimokita Peninsula, Japan - 107 mbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Japan Agency for Marine-Earth Science and Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1685
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor

Source Dataset Sampling Location

• Location Name: Shimokita Peninsula, Japan, in Northwestern Pacific
• Coordinates
  • Lat. (^o): 41.1773
  • Long. (^o): 142.2013
  • Depth (m): 1180.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070873	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052246_10010742	F070873	GGA	MAWGGSLNEEGSDHLRNLREADKVIKFLEKFKEDLNDNEKKLISNAIEIIVEHFTKNS*